Monday, May 17, 2021

RSN: Bess Levin | Of Course Donald Trump Jr.'s Ex-Wife Traded Him In for a Secret Service Agent

 

Reader Supported News
17 May 21


Urgent and Immediate Appeal for Donations

It is — very — important to get moving on donations, right here right now.

Yes we do need the money. Yes some people have helped. But we have to have a good month, whatever it takes. As of right now it’s not happening.

With urgency.

Marc Ash
Founder, Reader Supported News

Sure, I'll make a donation!


Update My Monthly Donation


If you would prefer to send a check:
Reader Supported News
PO Box 2043
Citrus Hts
CA 95611



 

Reader Supported News
16 May 21

It's Live on the HomePage Now:
Reader Supported News


READER SUPPORTED NEWS CANNOT SURVIVE — We've heard it time and again, from day one. This will not work, you have no chance, you cannot do this. We're doing it, but never with out the support of the public we serve. Take the plunge what you can afford, see where it goes, see what you are able to build here. In Peace and solidarity. / Marc Ash, Founder Reader Supported News

Sure, I'll make a donation!


Bess Levin | Of Course Donald Trump Jr.'s Ex-Wife Traded Him In for a Secret Service Agent
Vanessa Trump with Donald Trump Jr. (photo: Leigh Vogel/Wire Image)
Bess Levin, Vanity Fair
Levin writes: "Love. It works, as they say, in mysterious ways. And yet, in many cases, it actually works in entirely predictable, obvious, and reasonable ways."

Tiffany Trump was reportedly also a fan.


ove. It works, as they say, in mysterious ways. And yet, in many cases, it actually works in entirely predictable, obvious, and reasonable ways. For example, if you found yourself married to Donald Trump Jr., the mortifyingsimplemindedsheep-killing son of the 45th president, whose own father seems to despise him, you’d almost certainly replace him with a Secret Service agent, as Vanessa Trump, who found herself in that very situation, understandably decided to do.

In Zero Fail: The Rise and Fall of the Secret Service, Pulitzer Prize–winning journalist Carol Leonnig reports that Vanessa, the ex-wife of Donald Trump’s eldest son, started dating one of the agents who had been assigned to the family “shortly” after her 2018 divorce from Junior, according to The Guardian, which obtained a copy of the book. While agents are prohibited from forming personal relationships with the people they are assigned to protect, as such feelings could affect their judgment, the individual Vanessa was seeing was apparently not subject to disciplinary action because “neither he nor the agency were official guardians of Vanessa Trump at that point.”

According to Leonnig, Vanessa wasn’t the only Trump gal with an eye for the men assigned to the family:

Leonnig also writes that Tiffany Trump, Donald Trump’s daughter with his second wife, Marla Maples, broke up with a boyfriend and “began spending an unusual amount of time alone with a Secret Service agent on her detail.” Secret Service leaders, the book says, “became concerned at how close Tiffany appeared to be getting to the tall, dark and handsome agent.”

Both Tiffany Trump and the agent said nothing untoward was happening, Leonnig writes, and pointed out the nature of the agent’s job meant spending time alone with his charge. The agent was subsequently reassigned.

Tiffany is now engaged to Michael Boulos, the son of a Lebanese billionaire, who apparently popped the question in the waning days of the Trump administration. Leonnig, whose 2015 Pulitzer was awarded for her reporting on security failures at the Secret Service, notes that it’s not clear if Donald Trump was aware of what Secret Service personnel were discussing in regard to his daughter and daughter-in-law. Instead, he was focused on “repeatedly” trying to remove agents he believed were too short or overweight from his detail. “I want these fat guys off my detail,” Trump reportedly said, possibly not knowing the difference between office-based personnel and active agents. (Height and weight are famously important to the ex-president, who reportedly decided that Janet Yellen couldn‘t serve as Fed chair because she wasn’t tall enough.) Other Trumps, of course, had different issues with the Secret Service, like Jared Kushner and Ivanka Trump, who made the people assigned to protect them go to extreme lengths to “find a bathroom,” reportedly having banned them from using any of the six and a half facilities in their Kalorama mansion.

Vanessa and Don Jr. were married for 12 years before calling it quits, and as my colleague Kenzie Bryant memorialized at the time their divorce was finalized, this was the romantic story of how the two met, as told to The New York Times:

“I’m at this fashion show,” Ms. Trump said, recalling their meeting in 2003. “Donald Trump comes up to me with his son: ‘Hi, I’m Donald Trump. I wanted to introduce you to my son Donald Trump Jr.’”

The three engaged in a brief, awkward conversation.

At intermission, the elder Mr. Trump again noticed a gorgeous girl nearby.

“Donald comes back up to me again, ‘I don’t think you’ve met my son Donald Trump Jr.,’” Vanessa Trump recalled. She remembers responding, “Yeah, we just met, five minutes ago.”

Vanessa looked at the younger Mr. Trump “like we’re taking crazy pills,” he recalled. “You know, I’m 25 at the time, I did perfectly well with girls. It wasn’t really my M.O. to have my father try to pick up girls for me.”

Six weeks later, at a birthday party at the downtown restaurant Butter, they were introduced a third time, this time by a mutual friend. Neither remembered the other. “We talked for an hour,” she recalled.

Then suddenly, something clicked: Wait, you were at that fashion show. Wait, you’re...

“...the one with the retarded dad!” Ms. Trump blurted out.

Junior later got Vanessa’s engagement ring for free in exchange for a public engagement announcement at a New Jersey jeweler, which Donald Trump—yes, that Donald Trump— reportedly thought was a little déclassé.

READ MORE


Last July, Kayleigh McEnany, the White House press secretary, screened video of violence at protests in Portland, Ore., to justify federal intervention in the city. (photo: Stefani Reynolds/Bloomberg/Getty Images)
Last July, Kayleigh McEnany, the White House press secretary, screened video of violence at protests in Portland, Ore., to justify federal intervention in the city. (photo: Stefani Reynolds/Bloomberg/Getty Images)


Robert Mackey and Travis Mannon | Meet the Riot Squad: Right-Wing Reporters Whose Viral Videos Are Used to Smear BLM
Robert Mackey and Travis Mannon, The Intercept
Excerpt: "In the year since George Floyd's murder, conservative news outlets have endlessly hyped distorted stories about violence at Black Lives Matter protests."

In the year since George Floyd’s murder, conservative news outlets have endlessly hyped distorted stories about violence at Black Lives Matter protests. Key videos they used come from a tight-knit group of eight young journalists.

he sound of glass breaking, on Inauguration Day in Portland, Oregon, was music to the ears of Julio Rosas, a young video journalist.

That’s because Rosas, who works for the right-wing website Townhall, specializes in shooting viral video of mayhem at left-wing protests. On this day, black-clad, anti-capitalist protesters were attacking a Democratic Party office, and Rosas managed to record them from close range without being spotted.

Within minutes of the vandalism, by a handful of activists who broke off from a small #J20 march, Rosas posted his video on Twitter, where it racked up over 1 million views.

With his tweet, Rosas had also beaten his friend and rival, Jorge Ventura of the conservative Daily Caller, by six minutes.

Ventura, who went undercover to infiltrate the protest movement in Portland last summer, got less dramatic footage of this incident, but his 15-second clip, which showed that there were more people photographing the destruction in Portland than taking part in it, was still seen by more than 100,000 people.

When Rosas joined Laura Ingraham on Fox News that night, giving national attention to what would have been, before the era of viral video, just a local news story, Ventura held the camera for the live shot.

We know that because a third member of the conservative protest paparazzi that descended on Portland that day, Newsmax contributor James Klüg, gave viewers of his video blog a behind-the-scenes look at how the viral video-to-Fox News pipeline works.

On the air, Ingraham attributed the destruction to “antifa thugs,” using the right-wing shorthand that lumps everyone with left-of-center politics into one undifferentiated mass. Rosas, who was standing in front of a Circle-A — a symbol for anarchism, not anti-fascism — that had been spray-painted beside the ruined front door of the Democratic Party office, made no effort to correct her.

“The antifa groups here, they do not like Biden just as much they don’t like Trump,” he said. “They just hate America in general.” (In fact, Rose City Antifa, the Portland group that helped revive the Nazi-era concept of anti-fascism in the United States, released a statement making clear that this attack on the Democratic office was not the work of anti-fascists but rather of anarchists and anti-capitalists. “While many of the people involved may consider themselves antifascists in ideology,” the activists said, “we narrowly define antifascism as actions taken to oppose the insurgent right-wing.”)

As a reporter focused on protest movements, I’ve been studying video of chaotic events at demonstrations for more than a decade, since I live-blogged Iran’s disputed election and then covered the Arab Spring and Occupy protests, from the United States to Brazil. And one thing I’ve learned is that, whether a clip was posted online by a witness in Cairo or Kenosha, it always helps to know who shot the video, and why.

Over the past year, as I researched viral clips of contested incidents at protests against racist policing and far-right movements, I found that I was coming across the names of the same handful of videographers again and again. At protests in Minneapolis, Dallas, Seattle, Portland, Chicago, Los Angeles, New York, Washington, Louisville, Philadelphia, and Kenosha, Wisconsin, I discovered that many of the most viral clips were shot by a handful of field reporters for right-wing sites or freelancers with conservative politics.

Rosas and Ventura are not household names, but it’s important to understand their reporting, because they are members of an informal club of right-wing video journalists who roam from city to city, feeding the conservative media’s hunger for images of destruction and violence on the margins of left-wing protests.

In the year since George Floyd’s murder by Derek Chauvin was documented in horrifying detail on the cellphone of a 17-year-old witness, Darnella Frazier, right-wing news outlets and politicians have been desperate to draw attention away from those unbearable images by focusing instead on viral videos of unrest at racial justice protests. That’s been a boon for the careers of conservative video journalists like Rosas, Ventura, and a half-dozen of their friends, who jokingly call themselves the #RiotSquad in Instagram selfies and podcast banter.

The impact of their work is hard to overstate. Even as they remain relatively unknown, this tight-knit group has produced many of the most viral videos of Black Lives Matter protests over the past year. And those images have helped create the false impression, relentlessly driven home by Fox News and Republican politicians, that the nationwide wave of protests that erupted after George Floyd was killed was nothing but an excuse for mindless rioting.

That’s not to say that rioting never happens; it clearly does. And even if you believe that “a riot is the language of the unheard,” it is undeniable that looting and arson did scar some communities where anger over racist policing spiraled out of control.

But the broader picture is that Black Lives Matter protests have been overwhelmingly peaceful.

Conservatives like to mock anyone who says that, usually by pointing to isolated images of chaos, like those recorded by the Riot Squad, or by cherry-picking misleading data. Sen. Ron Johnson, a Wisconsin Republican, recently cited data showing that more than 500 racial justice protests turned violent in the United States last year. But Johnson failed to let readers of his Wall Street Journal opinion piece know that the same researchers — from the Armed Conflict Location & Event Data Project — counted nearly 10,000 more Black Lives Matter protests that were entirely peaceful. According to the researchers, there was no looting, arson, or violence of any kind at 94 percent of the protests associated with Black Lives Matter. And in many cases in which there was violence, it was inflicted on protesters, either by the police or right-wing vigilantes.

That’s the wide-angle view of reality missed by conservatives obsessively viewing close-up images of violence, like those shot by the Riot Squad and played on a loop on Fox News and other outlets even further to the right.

“Since the George Floyd protests, conservative media outlets including Fox News (particularly Tucker Carlson and Sean Hannity), One America News, Glenn Beck’s BlazeTV, and right-wing YouTubers have been covering Black Lives Matter and other left-wing protests daily, specifically highlighting instances of violence, fighting, and property damage,” media scholar Joan Donovan observed in the MIT Technology Review last summer. “This coverage has come to dominate the right-wing narrative in a new way, flipping the script to suggest that Black protesters — demonstrating because they fear police violence — are themselves a threat to white people.”

“By using riot porn to incite fear in white people,” Donovan added, “the right-wing media ecosystem converts the real pain experienced by Black Americans into fodder for deranged, paranoid fantasies that white vigilantes must take up the functions of the police.”

To understand how this works — and how a group of just eight young journalists have had such an outsize impact on what millions of Americans know about the protests against police violence and systemic racism — it’s useful to take a closer look at some of the most-watched clips posted online in the past year.

The Man Who Threatened Protesters With a Machete

The first and most obvious way that some of the Riot Squad journalists distort reality is through selective, misleading edits of the footage they shoot.

At a protest in Dallas five days after George Floyd was killed, a core member of the Riot Squad, Elijah Schaffer of Beck’s BlazeTV, posted a brief clip that showed the brutal beating of a white man by a group of mainly Black protesters.

The graphic, disturbing footage was viewed more than 35 million times on Twitter.

What Schaffer knew, but concealed from viewers of his edited clip, was that the man he described as an innocent victim of the mob had, moments earlier, threatened protesters with a machete.

Video recorded by another witness showed that the protesters responded by hurling stones at the man, who then shrieked and charged at them, swinging the blade wildly and cutting one of them, before the others disarmed him and took bloody revenge.

Yoel Measho, a filmmaker who took part in the protest, posted that video of the man’s wild charge on Snapchat, along with a second clip of a protester displaying the machete as protest medics gave the man first aid. (Measho later shared both clips with The Intercept.)

After the other videos began to circulate, Schaffer made the rest of his footage available to broadcasters, which showed that he had recorded but edited out the man’s aggressive behavior.

A Dallas police spokesperson told me the day after the incident that the man had indeed confronted protesters with the machete before being assaulted. The owners of the nearby bar the man reportedly set out to defend confirmed in a phone interview that the business was not looted by the protesters or anyone else. (On a conservative podcast the following month, a man who said he was the victim of the beating confirmed that he did initiate the conflict by confronting the protesters with a carbon steel machete “shaped like an old Roman gladius,” which he had mentioned on Twitter before the incident.)

Among those misled by Schaffer’s edit was then-President Donald Trump, who boosted it on Twitter and then echoed false claims that the man had died, as federal agents were unleashed on peaceful protesters outside the White House.

“Innocent people have been savagely beaten,” Trump told reporters, “like the young man in Dallas, Texas, who was left dying in the street.” (On the night of the attack, Schaffer had passed on the false rumor that the man had died.)

In the months that followed, Schaffer’s misleading clip was used again and again to smear Black Lives Matter. Johnson showed the video at a meeting of the Senate Homeland Security Committee he chaired last summer, presenting it as evidence of what he called “the reality” that protests against racist policing “unleash anarchy.” The clip was also included in a video prepared by Kyle Rittenhouse’s legal team, and then screened by Trump’s lawyers at his impeachment trial, as part of a misleading montage of protest violence, much of it recorded by Riot Squad videographers, which they falsely accused Democratic officials of having encouraged.

A Post-Election Skirmish in Washington

At the first post-election rally of Trump dead-enders in Washington in November, another Riot Squad videographer, Schaffer’s friend and former roommate Kalen D’Almeida, used the same technique to mislead millions of viewers.

The viral clip D’Almeida posted on Twitter (where it was viewed over 3 million times before he deleted it) and Instagram (as the second clip in this slideshow) showed an older white Trump supporter being punched in the face from behind by a young, Black counterprotester.

The video, which lingered on the man’s bloody face, was quickly retweeted by Andy Ngo and shared by Trump, with the comment: “Human Radical Left garbage did this.”

That video was then edited into an attack ad against Democrats that Trump screened for his fans at a rally in Georgia on December 5, much to D’Almeida’s delight.

But footage of the same clash recorded by Ventura showed that D’Almeida had edited his clip to hide the fact that the Trump supporter had started the fight, by first violently shoving one anti-Trump protester to the ground and then pushing and threatening to punch several others.

When D’Almeida later posted more of his own footage of the incident, it became clear that he had also recorded the start of the confrontation but chose to edit that out to make the white man look like an innocent victim of the Black protester.

Like the beating in Dallas that Elijah Schaffer witnessed, the punch that felled the Trump supporter in front of D’Almeida was obviously a vicious blow. But through selective, misleading editing, D’Almeida contributed in the same way to the sense of innocent victimhood and white resentment nurtured day and night by conservative media outlets and right-wing politicians like Trump.

Three months earlier, D’Almeida had posted a meme on Instagram mocking the mainstream media for supposedly distorting protest coverage. The meme, which uses two panels from a comic strip by the right-wing Colombian cartoonist Jhon Alexander Guerra, shows a TV news reporter telling a cameraperson not to film while a protester is throwing a rock at a police officer. When the police officer then chases the protester with his nightstick raised, the reporter tells the cameraperson to start shooting, because “now it’s news.”

Magnifying Two Incidents on the Streets of Portland

It was no accident that Rosas and Ventura chose to spend Inauguration Day this year in Portland. The liberal city’s strong anti-fascist protest culture, in a metro area surrounded by ultraconservative exurbs, has for years provided right-wing video journalists with a steady stream of skirmishes to record and exaggerate.

In July, for instance, Ventura and the Riot Squad’s Drew Hernandez, a right-wing YouTuber, both recorded an angry confrontation between Portland police officers and a Black, female protester who objected to being shoved forcefully by three officers.

“God damn it! I’m disabled, I can’t walk any faster!” the woman could be heard saying in the viral clip Hernandez recorded.

“Go!” one officer replied.

“I hope someone kills your whole fucking family,” the enraged woman responded. “I hope they kill you too. I hope someone burns down your whole precinct with all y’all inside. Can’t wait to see it.”

Hernandez’s clip was immediately boosted on Twitter by Ngo and even screened for the White House press corps by press secretary Kayleigh McEnany, in a montage of Portland unrest intended to justify federal intervention in the city. (The montage also included video shot by Ventura and his boss, Richie McGinniss.)

The White House, however, edited the Hernandez clip for McEnany’s presentation, removing the start of the confrontation to conceal from reporters that the protester’s comments were in reaction to having been roughly treated.

The following month, D’Almeida recorded a shocking act of violence on a Portland street, five blocks from the main protest site.

Typically dressed in black to blend in, D’Almeida describes himself on Instagram as an “Undercover Exposé Artist,” making no secret that his aim in filming protests against police brutality is to capture footage that can be used to discredit anti-fascists or Black Lives Matter activists.

While he began that effort in Seattle, D’Almeida finally hit the jackpot in August, when he recorded, on both his cellphone and body camera, graphic video of a white man being kicked in the face and knocked out by a Black man who provided security at Portland protests.

Hernandez and Ventura were also on hand to capture gruesome video of the aftermath, as the injured man, who was accused by his attacker of trying to run people down with his truck, lay unconscious and bleeding.

The video of the victim shared by Hernandez, with a caption attributing the violence to “BLM militants,” went even more viral.

The incident got so much attention on Fox News that the culprit, Marquise Love, who was later jailed for the assault, became a symbol of Black Lives Matter for many of the network’s viewers.

That this brutal attack had not taken place during a protest, but after one, and at another location, where a long series of confusing, overlapping arguments among people drinking and smoking outside a nearby 7-Eleven escalated to violence was not something D’Almeida tried to explain to viewers of his video.

Hernandez later tried to connect the attack to the protests by claiming that the victim, Adam Haner, had been assaulted for coming to the defense of a trans woman who was assaulted by “Black Lives Matter protesters.” In fact, a careful review of raw footage posted online later by Hernandez shows that the incident started after Love, the self-appointed security guard, left the site of a protest and encountered Haner drinking beer outside the 7-Eleven. The two men eventually took opposite sides in a nasty personal dispute there that had nothing to do with politics or the demonstrations.

What Hernandez left out of the narrative he shared with Fox News is that his footage shows that the dispute between Love and the trans woman at the 7-Eleven only escalated after that person took out a baton and threatened the security guard with it.

Right-Wing Vigilantes in Kenosha

Last August, all eight Riot Squad videographers converged on Kenosha, Wisconsin, to cover protests that gave way to arson and destruction following the police shooting of Jacob Blake.

The unrest also prompted members of a libertarian militia to take to the streets.

Almost everything we know about how one member of that militia, Kyle Rittenhouse, ended up killing two men in Kenosha that week comes from the Riot Squad reporters, who were there to document violence by anti-police protesters but instead recorded video of a pro-police vigilante shooting demonstrators.

On the second night of protests in Kenosha, Ventura and Schaffer, who was disguised in a Black Lives Matter shirt, came across protesters arguing with a libertarian militia guarding a gas station.

Both recorded a tense political debate between a young, Black protester and a heavily armed militia leader wearing a tactical vest with an embroidered patch showing a Teenage Mutant Ninja Turtle and the slogan “Cowabunga It Is,” a reference to a Reddit meme.

“That attempted murder of that citizen was wrong,” the white militia member said of the shooting of Blake. “And I’m all for protests, but you can’t be destroying your neighbor’s houses and businesses,” he added.

“This shit, the fucking value of property, has nothing to do with the value of life,” the protester shouted at him. “If you value this shit more than you value people, you’re not with us! Fuck you! You’re not with us!”

In his Periscope livestream from the same location, Schaffer gushed over the vigilantes.

“What do you think about vigilantism where the police are not able to protect businesses, so citizens are coming in, and they’re protecting businesses themselves?” Schaffer asked a bystander.

“I feel a hundred percent,” the man replied.

“I’m with it too. I’m jiving with it,” Schaffer agreed. “I like that shit. That shit’s tight. Hell, yeah. These people are like God, right here. They’re protectors.”

Two blocks away, Ventura and Schaffer joined Rosas in front of a burning office furniture store, which provided the perfect backdrop for all three to record dispatches from the scene.

In his stand-up report, Rosas credited the “armed citizens” for stopping the ransacking of a car dealership and threw in a dig at the MSNBC anchor Ali Velshi, who had been accused by conservatives of downplaying arson while reporting from Minneapolis on the first George Floyd protests.

“What’s up everybody, so right now we’re still here in Kenosha,” Rosas said. “Riots are still going on right now where the curfew is still technically in effect, but as you can see, a lot of the people are still out and about. Obviously a burning building behind me, or, as Ali Velshi would say, not an unruly protest.”

When it was Schaffer’s turn to use the same burning building as a backdrop, he let viewers in on the secret that he was just pretending to sympathize with the protesters in order to expose them.

“My name’s Elijah Schaffer, reporting for BlazeTV, undercover, here in Kenosha,” he signed off. “Thank you again so much for watching. Have a great rest of the night and may God bless the United States of America.”

Within days, that stand-up was featured in a BlazeTV commercial for Schaffer’s show. “America’s streets have become a war zone,” a narrator intoned in the ad, “and Elijah Schaffer is right in the middle of it.” The ad copy promised that Schaffer would bring subscribers “what the mainstream media won’t show you”: endless images of fire and property damage, along with the young conservative’s “thought-provoking perspective.”

As he reported on racial justice protests last summer, Schaffer’s commentary on the movement against police brutality became increasingly unhinged. “Ultimately,” Schaffer tweeted in September, “I believe BLM, if left unchecked, would eventually produce genocidal outcomes.”

The next night, Schaffer and the Daily Caller’s head of video, Richie McGinniss, both interviewed a 17-year-old who had joined the militia: Rittenhouse.

As that night wore on, protesters eventually tired of being policed by vigilantes and let the militia know. As tensions between the two groups escalated, video shot by Rosas and the Daily Caller’s Shelby Talcott showed the three men Rittenhouse would shoot that night — Gaige Grosskreutz, Joseph Rosenbaum, and Anthony Huber — in the middle of the heated dispute.

After Schaffer interviewed Rittenhouse, he went to a nearby car dealership that was being vandalized. Moments later, Rittenhouse ran into that car lot, pursued by Rosenbaum, a protester enraged by the teenage vigilante’s presence.

Video recorded by a protest livestreamer showed that McGinniss, who was following Rittenhouse when the chase began, was running just behind Rosenbaum with his iPhone pointed at the two men when Rittenhouse turned and fired four shots, striking the protester from point-blank range.

Because McGinniss was just a few feet behind Rosenbaum when Rittenhouse opened fire and appeared to be filming, the fact that he released no video of the shooting that night led some observers to wonder if he, or the Daily Caller, might have decided to suppress or delete footage that could be used to convict the young right-wing vigilante.

Hernandez captured the shooting from across the lot and then continued filming as he moved in closer.

While McGinniss ripped off his Black Lives Matter T-shirt and tried to stop Rosenbaum’s bleeding with it, Rittenhouse ran past Hernandez, calling a friend instead of 911.

Close-up images of the scramble to save Rosenbaum, recorded by Hernandez and Schaffer, showed that McGinniss’s cellphone, which was in his left hand as he administered first aid with his right, was in record mode at the time.

The phone’s engaged red record button, the presence of a white shutter button on the screen’s lower right, and the red block around the time code at the top are three signs that an iPhone is recording, and all are visible on McGinniss’s phone in the video recorded by Schaffer and Hernandez.

That fueled speculation that McGinniss might have withheld incriminating visual evidence to shield Rittenhouse, who quickly became a hero to many of the Daily Caller’s far-right readers and was defended by the site’s founder, Tucker Carlson.

McGinniss, however, told The Intercept that while he thought he had recorded video of the shooting, he discovered later that he had accidentally hit the wrong button on his iPhone and it did not start recording until after the shots were fired.

As Rittenhouse ran from the lot, Talcott filmed protesters shouting that he had shot someone. Moments later, Rittenhouse tripped and fell in front of Rosas, who recorded the teen vigilante shooting at the men who tried to disarm him.

Rosas, who is in the Marine Reserves, quickly took cover, but another young video journalist, Brendan Gutenschwager, ran past him and got the clearest images of Rittenhouse shooting Huber, who died of his wounds, and Grosskreutz, who was badly injured but survived.

As Rittenhouse rose to his feet, with Huber sprawled on the street in front of him and Grosskreutz retreating, Gutenschwager could be seen just behind the gunman, filming from the sidewalk.

Within 10 minutes of the first shooting, Hernandez and Schaffer both posted their video of the fatally wounded Rosenbaum on Twitter, along with captions that maligned the victim. Hernandez described Rosenbaum as a “rioter,” while Schaffer made the false claim that the man had been shot “while looting a car shop.”

On his BlazeTV show later that week, Schaffer continued to attack the victims, falsely accusing them of committing crimes and praising the right-wing vigilante for killing them.

“I really don’t have sympathy for them. I just do not. They were rioters, they were vandalizing the place. And, do crimes, get rekt, that’s what I have to say,” Schaffer told his viewers. “I think them attacking Kyle Rittenhouse, with a skateboard, a pistol, and trying to jump him is what makes them deserve to be shot. I think Kyle’s been memed into history.”

“Kyle is a hero in my eyes,” Schaffer added. “Next time commies come up on a patriot like that, watch out.”

Gutenschwager is the only Riot Squad videographer who is not either employed by a conservative news site or openly right-wing. But before he started filming protests, Gutenschwager traveled the country as something of a Donald Trump groupie, attending at least 24 Trump rallies before the 2018 midterms and describing them as “exhilarating” on his video blog.

Gutenschwager’s footage of left-wing protesters behaving badly has earned him invitations from Ingraham to appear on Fox News, but he promises fans of his Twitter feed who provide financial support that they can rely on him to report “the unbiased truth from the ground.” He also sells his footage through the news agency Storyful, which is owned by Rupert Murdoch’s News Corp., but licenses video from social media video to broadcasters across the political spectrum.

Even so, Gutenschwager’s video of mayhem at left-wing protests is frequently used by right-wing outlets and meme creators to smear demonstrators.

For instance, when Gutenschwager got viral video of a left-wing protester being set on fire by a Molotov cocktail in Portland last summer, it quickly turned into a right-wing meme mocking the protester’s pain and was retweeted by Trump’s social media caddy, Dan Scavino.

Who Rented the U-Haul in Louisville?

When the Riot Squad rolled in to Louisville, Kentucky, in September to cover protests over the decision to not charge the police officer who shot Breonna Taylor with killing her, Gutenschwager was alongside Talcott and Rosas.

All three recorded a scene that quickly became the focus of huge attention on the right: protesters picking up banners and shields from a rented U-Haul truck.

The fact that left-wing protesters prepare to demonstrate should hardly be surprising, but the Riot Squad video of the U-Haul reignited baseless right-wing conspiracy theories that Black Lives Matter protesters must be secretly employed by George Soros.

As the three video clips racked up more than 11 million total views on Twitter and flooded conservative networks, Rush Limbaugh, Sean Hannity, and Ingraham all demanded to know who had rented the truck — as if only a billionaire could afford a U-Haul.

“Video Evidence Does Not Lie”

Speaking to Glenn Beck after Rittenhouse killed two protesters in Kenosha, Schaffer scoffed at the notion that the Riot Squad’s reporting was biased and complained that Twitter, in its breaking news section, had featured reports from national newspapers whose writers did not witness the shootings instead of the conservative video journalists who did.

“The people who were there, I would say this: Even if you don’t like their commentary, video evidence does not lie,” Schaffer said. Referring by name to Ventura, Rosas, Talcott, McGinniss, D’Almeida, and Hernandez, Schaffer told Beck that this group of people was “just eager to show America what is actually happening.”

Schaffer, who was caught distorting video of the news event he witnessed in Dallas, was not the ideal spokesperson for the argument that the personal politics of a video journalist should be ignored. But it is true that several of the Riot Squad reporters are not as overtly partisan as Schaffer, D’Almeida, or Hernandez.

McGinniss, who appeared in a reality show about the 2016 election as an undecided voter, worked for the far-right pundit Mark Levin but says he campaigned for Obama in 2008. Talcott denounced the January 6 attack on the Capitol as a riot, and wrote on Instagram last June that she had witnessed “incredible scenes of moving, peaceful protests as well as violent anarchy” while “reporting on a historic #BlackLivesMatter milestone.” Then again, she also spoke at the far-right Conservative Political Action Conference this year, in conversation with Rosas.

And while Gutenschwager once complained of anti-Trump comments in an official New York University publication after he dropped out of the school, his video of the Proud Boys burning a Black Lives Matter banner they stole from the Asbury United Methodist Church was even featured in an impassioned denunciation of the attack on the Black church from Chris Hayes on MSNBC.

But Joan Donovan, the media researcher, argues that the way footage of violence and disorder at left-wing protests is used by right-wing news outlets, and consumed by conservative viewers, is more important than the personal views of the journalists who hold the cameras.

By focusing on sensational, graphic images of violence on the margins of protests and entirely ignoring peaceful demonstrators, even members of the Riot Squad who are not as far right as Schaffer have contributed to a political project: the right-wing media’s campaign to portray racial justice protests as anarchic and dangerous.

What’s more, as Donovan wrote last summer, viewing what she calls “riot porn” often “enrages and traumatizes” those who watch it. Being bombarded with viral videos of violence at left-wing protests might even have motivated some reactionaries to take to the streets, either in anti-anti-fascist fight clubs, like the Proud Boys, or armed militia groups, like the one Rittenhouse joined in Kenosha.

“Fed into a media ecosystem with an established bias toward highlighting violence and rioting, the videos have mobilized white militia and vigilante groups to take up arms against Black Lives Matter and ‘antifa’ protesters,” Donovan wrote. “This feedback circuit has created a self-fulfilling cycle where white vigilantes feel justified in menacing and physically attacking racial justice protesters — and inspire others to do the same.”

Rittenhouse’s legal team made a similar argument in a strange promotional video laying out his claim to have acted in self-defense. The video suggested that his thinking was influenced by episodes of violence at left-wing protests that he’d seen on video.

“Did Kyle Rittenhouse have reason to believe his life was in danger?” the video’s narrator asks at a key moment. That question is answered with a montage of viral videos of violence from earlier in the summer, including D’Almeida’s video of the man being kicked in the face in Portland, Hernandez’s video of a Black woman tackling a white woman just before that incident, and Schaffer’s video of the man being pummeled in Dallas.

The sequence ends with video of Aaron “Jay” Danielson, a member of the far-right group Patriot Prayer who was gunned down by an avowed anti-fascist, Michael Reinoehl, in Portland. But the suggestion that Danielson’s murder might have contributed to Rittenhouse’s fear of left-wing violence is clearly false, since that killing, the first by a self-described anti-fascist in 27 years, took place on August 29, four days after Rittenhouse shot the three protesters in Kenosha, killing two of them.

In other words, even when the Riot Squad videographers accurately record unrest they witness, their selective focus on unrest after police shootings helps conservative outlets demonize Black Lives Matter protesters.

For a textbook example of how this works, look at how the Riot Squad covered a racial justice protest in Philadelphia last October, a week before the election.

Leaving a Peaceful Protest to Film Looting Across Town

Protests erupted in West Philadelphia after a bystander filmed the fatal police shooting of Walter Wallace Jr., a Black man whose family said he was experiencing a mental health crisis.

That night, after the police clashed with protesters in the neighborhood, there was some vandalism and looting, which Wallace’s family forcefully condemned.

The next night, SchafferRosasVenturaTalcott, and McGinniss were all on hand to film protesters rallying peacefully at a park in West Philadelphia and then march to a police station. They filmed a tense face-off between protesters and a line of officers outside the station, but since there was no violence, only one of their clips got any traction on social media: video of a woman screaming a racial epithet at the police.

Later that night, there were minor skirmishes in West Philadelphia, but by then the Riot Squad had left the protest and driven across the city to cover a more telegenic scene: the mass looting of a shopping center 10 miles away.

As Talcott and Rosas filmed inside a ransacked Five Below discount store there, looters could be heard telling Schaffer to stop recording them and then seen punching him in the mouth.

That video of Schaffer being assaulted was viewed over 1 million times, as was a clip in which he wrongly identified his assailants as “Black Lives Matter protesters.”

“What happened,” Schaffer told viewers, “is I just went into the Five Below to see what was going on with some of the looting, and I was jumped by the Black Lives Matter protesters, who immediately started punching and kicking me.”

In fact, as Talcott later acknowledged in an interview on “Tucker Carlson Tonight,” the videographers had to drive 30 minutes away from the protest by Wallace’s neighbors, in West Philadelphia, to film at the retail center in another part of the city, where there were no protesters, only looters taking advantage of the overwhelmed police force.

But the viral video of the attack on Schaffer struck a nerve with conservative viewers and helped make the looting in one part of the city, not the peaceful protest in another, the focus of days of misleading, politicized coverage on Fox.

Following Schaffer’s lead, Carlson even referred to the looters in Philadelphia as “more than a thousand BLM activists — Joe Biden voters.”

Embedded With the Pro-Trump Thugs

While their work is mainly used to undermine left-wing protesters, Kenosha isn’t the only place Riot Squad videographers have captured images of right-wing political violence.

After a pro-Trump rally in Washington in December, D’Almeida, Gutenschawger, and Talcott recorded a mob of Proud Boys ripping Black Lives Matter banners from Black churches and trashing or burning them.

And on January 6, Gutenschwager’s viral video of Proud Boys member Dominic Pezzola using a stolen police riot shield to break a window and gain entry into the Capitol was one of the iconic images of the day. It was later used to indict Pezzola, and it was screened by the House managers at Trump’s impeachment trial.

Nearby, Hernandez filmed Trump supporters described as “patriots” attacking the police.

Schaffer tweeted viral footage of police lines being breached and then followed people he called “revolutionaries” into House Speaker Nancy Pelosi’s office.

Rosas showed Trump cultists battering the doors of the Capitol and then trashing the camera equipment of television crews trying to report on the raid.

McGinniss ended up scoring a viral hit with a friendly interview of a Trump supporter smoking a joint under the Capitol dome.

Still, on Fox News and elsewhere inside the conservative media bubble, all this video evidence of right-wing violence was not used to vilify the rioters the way that clips of far less significant events at left-wing protests were last summer.

Left-Wing Activists Target Riot Squad Video Journalists

While the Riot Squad video journalists are still mostly unknown to people who are not addicted to Fox News, some of their faces have become familiar to left-wing activists. That’s led to the violent suppression of their reporting on more than one occasion in recent months.

At an anti-eviction protest in Detroit in April, several activists tried to stop Gutenschwager from filming, blocking his lens and ordering him to leave. As Gutenschwager objected, one of them, a man wearing a pin with an anti-fascist symbol on it, replied: “Get out of here you fucking Nazi.”

When Gutenschwager asked what he had done, another activist, who was livestreaming the protest himself, replied: “Dude, you were in the Capitol!”

Moments later, an activist photographer got in Gutenschwager’s face and told him: “You’re not fucking welcome here.”

The left-wing livestreamer then made it plain to his own viewers that he knew Gutenschwager’s work by referring to him, imprecisely, by his Twitter handle. “So this is BGOonTheScene. He’s not welcome here,” the man said, as he filmed Gutenschwager from close range. “He’s not welcome here and he continues to be here, ’cause this guy was in the Capitol building on the 6th.”

According to Gutenschwager, he was then slammed into a barrier by another man, who put him in a chokehold, bloodied his mouth, and hurled his camera over a fence.

After he retrieved his camera, Gutenschwager was threatened by the activist photographer, who accused him of selling footage to Breitbart that could be used to identify protesters, opening them up to harassment.

There have been similarly troubling scenes at right-wing rallies, where Proud Boys and other militant right-wingers have attacked video journalists they suspect of being left-wing activists.

At a Proud Boys rally in Portland last September, an armed man even told the videographer Ford Fischer, who is suspected by some on the left of harboring right-wing sympathies, “We know that you’re antifa.”

Fischer, who was overheard in another videographer’s recording telling the right-wing security guards who wanted him to leave, “I’m, like, very friendly with a lot of people here,” tweeted that he was eventually saved by the Proud Boys’ leader, Enrique Tarrio, who “told them I’m independent and to leave me alone.”

Kalen D’Almeida’s Cover Gets Blown

In this hyperpartisan environment, activists on both the right and the left fear that video will be used against them and are increasingly trying to insist that their events should be documented only by like-minded videographers.

That’s one of the main reasons that so much of the video of the right-wing raid on the Capitol was recorded by people who at least seemed to the participants to be on their side.

Two months before the attack on Gutenschwager, right-wing protesters in Huntington Beach, California, even tried to stop D’Almeida from filming their rally, accusing him of being “antifa” because he was dressed in black and wearing a mask.

The confused face-off amused left-wing activists monitoring a right-wing livestream of the rally in support of Tito Ortiz, a former MMA fighter-turned-city council member who has been leading local conservative resistance to mask-wearing and racial justice protests.

“You’re filming us, and you’re trying to dox us, so why are you doing that? You’re not welcome here,” a rally organizer with a bullhorn told D’Almeida. “How about you leave. We don’t want lying journalists like you. Get out of here, scum.”

D’Almeida, who had spent months posing as a supporter of left-wing protests in order to undermine them, tried to signal to this crowd that he was on their side. “Does anyone want to look me up right now?” he said. “My name’s Kalen D’Almeida, I’m a reporter. I’ve been retweeted by Donald Trump.”

When one right-wing protester asked who D’Almeida worked for, he named the news site he founded with two graduates of a Christian college outside Los Angeles. “Scriberr News,” D’Almeida said. “We’re out of Fountain Valley, we’re nonpartisan.”

“Nonpartisan? What does that mean?” the man with the bullhorn asked skeptically.

In April, D’Almeida ran into more serious trouble when he was recognized by people on the left who are familiar with his work while livestreaming a Black Lives Matter march for Daunte Wright in Los Angeles.

After one protester snatched D’Almedia’s cellphone, video from a left-wing livestreamer showed that other marchers surrounded him and jeered at him to leave. “Nazis go home! Nazis fuck off!” protesters chanted as D’Almeida was surrounded. “Get the fuck out of here you piece of shit!”

D’Almeida was then punched and briefly knocked out, before a female protester intervened. Another undercover right-wing videographer, Tomas Morales, showed that before the woman sent D’Almeida on his way, she scolded him for undermining the protest movement.

“Listen, people are fighting for their fucking lives, this is not a joke. Leave us the fuck alone! Look at my face. I saved you this time,” the woman told D’Almeida.

As he rose uneasily to his feet and tried to get his bearings, the woman pushed D’Almeida away. “Get the fuck out of here,” she told him. “’Cause this is your last chance. You’re lucky. Get out of here.”

One left-wing activist suggested later that D’Almeida had brought the attack on himself by acting more like an undercover political operative looking for dirt on the protesters than a truly nonpartisan journalist. “Don’t be a fucking fascist and this shit wouldn’t happen, Kalen,” the activist tweeted at D’Almeida. “Fascism is an extremely poor life choice.”

The next day, left-wing activists in Portland assaulted a well-regarded local video journalist — apparently for failing to accede to demands to “protect” protesters who wanted to conceal their identities from right-wing enemies. In Oakland that night, a left-wing blogger reported that he was harassed by protesters for just having a camera, and witnessed assaults on two other photographers.

Violence against journalists, even ones operating in bad faith, is inexcusable. Unfortunately, videographers like D’Almeida have contributed to an atmosphere of paranoia and mistrust, making assaults on journalists more frequent. And this has also made the work of scrupulous and fair reporting on the politics that plays out on our streets much harder, and more dangerous.

READ MORE


In May hundreds of people joined Daunte Wright's family and friends on a march through the Minneapolis suburb where he was fatally shot by a police officer during a traffic stop three weeks earlier. (photo: AP)
In May hundreds of people joined Daunte Wright's family and friends on a march through the Minneapolis suburb where he was fatally shot by a police officer during a traffic stop three weeks earlier. (photo: AP)


Brooklyn Center in Minneapolis Votes Through Sweeping Police Reform After Fatal Shootings of Black Men
Alice Hutton, Yahoo! News
Hutton writes: "A Minneapolis suburb, the scene of fatal police shootings of Black men, has voted through a police reform bill to overhaul public safety."

The city council of Brooklyn Center voted 4-1 on Saturday to pass the resolution which would reduce police powers as well as create an unarmed unit to respond to incidents involving medical, mental healthdisability, social and behavioural issues.

The bill will be named after two men, Daunte Wright and Kobe Dimock-Heisler, who were killed during encounters with city law enforcement officers.

Mayor Mike Elliott said in a written statement posted on Facebook that the Daunte Wright and Kobe Dimock-Heisler Community Safety and Violence Prevention Resolution was a “commitment to do better.”

He said: “This resolution -- which is a reflection of hours of community testimony over the past few weeks -- will transform our system so that police are not the only available response for everything. It creates a way to send civilian and community-based responses and also increases transparency, accountability, & community input.”

This is just the first step in a long road ahead -- but that is work that we as a city are ready to do with our community. On April 11, Daunte Wright, 20, was fatally shot during a traffic stop by a police officer in Brooklyn Center. Officer Kim Potter, 48, has been charged with second-degree manslaughter after claiming she accidentally fired her gun, mistakenly grabbing it instead of her Taser. She has not yet entered a plea.

In 2019 Kobe Dimock Heisler, 21, was shot dead by officers who responded to a 911 call from his grandfather who was having trouble calming him down following an argument. Mr Heisler had a history of mental health problems and was on the autism spectrum.

No charges were filed against the officers.

After the vote Katie Wright, Daunte Wright’s mother, said that her son would still be alive if these measures were in place on April 11.

“I don’t wish this on anybody in the room, and in order for this to not happen, we need this resolution,” Ms Wright said.

Brooklyn Center is around ten miles from where George Floyd, a Black man, was murdered by former police officer Derek Chauvin in May 2020.

Mr Floyd’s death sparked global protests calling for racial justice and an end to police brutality. Chauvin was convicted of murder in April and is facing decades in prison.

The Brooklyn Center reforms will include a committee of experts to advise on how to take a public health-oriented approach to community safety, as well as an oversight committee for the Brooklyn Center Police Department.

There will be an unarmed community response team to assist with mental health and medical crises meaning that 911 calls of this nature would be rerouted away from the police department.

A “citation and summons” policy will be implemented to stop officers making arrests or searching vehicles during non-moving traffic violations.

Jaylani Hussein, executive director of the anti-racism non-profit, CAIR-MN, said: “It’s about saving lives and protecting the most vulnerable in our community, individuals who are dealing with mental health crises and their families and those who are poor in this city, work hard every day, and pulled over by police for no reasons.”

READ MORE


A spokeswoman for Bill Gates said claims that he mistreated employees were false. (photo: Elaine Thompson/AP)
A spokeswoman for Bill Gates said claims that he mistreated employees were false. (photo: Elaine Thompson/AP)


Long Before Divorce, Bill Gates Had Reputation for Questionable Behavior
Emily Flitter and Matthew Goldstein, The New York Times
Excerpt: "By the time Melinda French Gates decided to end her 27-year marriage, her husband was known globally as a software pioneer, a billionaire and a leading philanthropist."

Melinda French Gates voiced concerns about her husband’s relationship with Jeffrey Epstein and a harassment claim against his money manager. He also had an affair with an employee.

But in some circles, Bill Gates had also developed a reputation for questionable conduct in work-related settings. That is attracting new scrutiny amid the breakup of one of the world’s richest, most powerful couples.

In 2018, Ms. French Gates wasn’t satisfied with her husband’s handling of a previously undisclosed sexual harassment claim against his longtime money manager, according to two people familiar with the matter. After Mr. Gates moved to settle the matter confidentially, Ms. French Gates insisted on an outside investigation. The money manager, Michael Larson, remains in his job.

READ MORE


President Joe Biden in Washington, DC, 2021. (photo: Saul Loeb/AFP/Getty Images)
President Joe Biden in Washington, DC, 2021. (photo: Saul Loeb/AFP/Getty Images)


Child Cash Benefit Will Begin Hitting Millions of Parents' Bank Accounts July 15
Jeff Stein, The Washington Post
Stein writes: "The Biden administration announced Monday that roughly 39 million American families will begin receiving direct cash payments in July under a new child benefit created by Democrats' coronavirus relief bill."

Administration estimates 88 percent of all American children are slated to receive new monthly payments -- with no action required


he Biden administration announced Monday that roughly 39 million American families will begin receiving direct cash payments in July under a new child benefit created by Democrats’ coronavirus relief bill.

The Internal Revenue Service will on July 15 start delivering a monthly payment of $300 per child under 6 and $250 per child older than 6 for those who qualify. The monthly benefits will be deposited directly in most families’ bank accounts on the 15th of every month -- or the closest day to that date, if the 15th falls on a holiday or weekend -- for the rest of the year, without any action required. For instance, an eligible family with two children aged 5 and 13 will receive $550 from the IRS directly to their bank accounts on or close to the 15th of every month from July to December.

Biden administration officials estimate that households representing more than 65 million children -- or 88 percent of all U.S. kids nationwide -- will begin receiving the benefit through direct deposit, paper checks, or debit cards. Of that population, roughly 80 percent of that population will be sent the cash directly via direct deposit, administration officials told reporters on a call Sunday. High-income parents will receive a smaller benefit or none at all, depending on how much they make. The credit diminishes for individuals with adjusted gross income of more than $75,000, as well as couples earning more than $150,000.

The new program represents one of the most important Biden domestic policy initiatives and could have significant political consequences as the White House seeks to reshape the U.S. economy. In March, Congressional Democrats approved a $1.9 trillion relief plan that expanded an existing $2,000-per-child benefit, increasing its annual value to $3,600 per child under 6 and to $3,000 for older children. The benefit was also expanded to cover tens of millions of low-income families who were previously too poor to receive it in full. America has had one of the highest child poverty levels among rich nations, something supporters of the expanded benefit hope to change.

The Biden administration is now working to implement that law. Congressional Democrats had intended to require the IRS to send the payments out monthly, a measure designed to accommodate families’ short-term income shocks. They were ultimately forced to leave the timing question up to the tax agency under the arcane rules of the legislative procedure they used to pass the measure. The IRS on Monday for the first time said they will be able to administer it on a monthly basis, in line with many Democrats’ original intention.

Biden proposed extending the enhanced child benefit through 2025 in the “American Families Plan” he introduced last month. He has also said the administration aims to make the new benefit permanent, although how Democrats would do so remains unclear.

“With two parents, two kids, that’s $7,200 in the pockets you’re getting to help take care of your family,” Biden said in his address to Congress in April. “And that will help more than 65 million children and help cut childcare poverty in half, and we can afford it.”

Conservatives have strongly criticized the measure, particularly because it changed the existing program by giving the same amount to parents who do not work as parents who do. Congressional Republicans have said the plan will discourage parents from working. Traditionally, both Democrats and Republicans have resisted giving direct cash benefits to non-working families -- a stance that began to shift during the pandemic, when Congress on a bipartisan basis sent hundreds of billions in stimulus payments.

The expanded credit is estimated to cost approximately $150 billion per year, according to the Committee for a Responsible Federal Budget, a nonpartisan think-tank.

“Democrats chose ... simply handing out cash to parents, including ones already on welfare or in households where nobody is working,” Sens. Marco Rubio (R-Fla.) and Mike Lee (R-Utah) said in a statement last month. "This kind of universal basic income makes more Americans dependent on government and severs the vital elements — work, marriage, community, and beyond — required to raise healthy families

Significant implementation problems loom that could hamper the program’s effectiveness. Eligibility is based on prior year income status, which is necessary for the IRS to prevent rich Americans from receiving the benefit. But that decision opens up other implementation challenges, as family income and custodial status can change frequently.

Administration officials also told reporters Sunday they will create two separate online portals to help Americans receive their payments from the IRS. One is for Americans who do not traditionally file income taxes. It would in particular help poor Americans and groups that work with the homeless to secure their new benefit. The second, separate portal will allow families to tell the IRS about changes in custodial status, or for the family to tell the IRS it wants to receive the benefit in full at tax time at the end of the year rather than on a monthly basis.

These measures could still prove difficult to implement. However, administration officials stressed that the vast majority of families had to do nothing to receive the benefit.

READ MORE


Shoes of those who died of an opioid overdose on the steps of the West Virginia capitol in Charleston. (photo: Chris McGreal/Guardian UK)
Shoes of those who died of an opioid overdose on the steps of the West Virginia capitol in Charleston. (photo: Chris McGreal/Guardian UK)


Big Pharma Executives Mocked 'Pillbillies' in Emails, West Virginia Opioid Trial Hears
Chris McGreal, Guardian UK
McGreal writes: "Executives at one of the US's largest drug distributors circulated rhymes and emails mocking 'hillbillies' who became addicted to opioid painkillers even as the company poured hundreds of millions of pills into parts of Appalachia at the heart of America's opioid epidemic."

The trial of pharmaceutical firms accused of illegally flooding West Virginia with opioids was told last week that senior staff at AmerisourceBergen, the 10th-largest company in the US by revenue, routinely disparaged communities blighted by the worst drug epidemic in the country’s history.

One email in 2011 included a rhyme built around “a poor mountaineer” named Jed who “barely kept his habit fed”. According to the verse, “Jed” travels to Florida to buy “Hillbilly Heroin”, the nickname for OxyContin, the drug manufactured by Purdue Pharma which kickstarted an epidemic that has claimed more than 500,000 lives.

Florida was well known through the 2000s for lax regulation of pain clinics where doctors illegally prescribed and dispensed large amounts of opioids to those the verse calls a “bevy of Pillbillies”.

Another rhyme described Kentucky as “OxyContinville” because of the high use of the drug in the poor rural east of the state.

When Kentucky introduced new regulations to curb opioid dispensing, an AmerisourceBergen executive wrote in a widely circulated email: “One of the hillbilly’s [sic] must have learned how to read :-)”.

Another email contained a mocked up breakfast cereal box with the word “smack” under the words “OxyContin for kids”.

One of those who wrote and circulated disparaging emails was Chris Zimmerman, the senior executive responsible for enforcing AmerisourceBergen’s legal obligation to halt opioid deliveries to pharmacies suspected of dispensing suspiciously large amounts of the drugs, often in concert with corrupt doctors who made small fortunes writing illegal prescriptions.

After Florida cracked down on pill mills in 2011, Zimmerman sent an email to colleagues. “Watch out George and Alabama,” he wrote, “there will be a max exodus of Pillbillies heading north.”

Zimmerman told the trial he regretted circulating the mocking rhyme but it was “a reflection of the environment at the time”. He claimed the emails were simply a means of expressing frustration as the company worked to prevent opioids falling into the wrong hands. Zimmerman said the company culture was of the “highest calibre”.

Paul Farrell, a lawyer for a West Virginia county, put it to the executive that the emails reflected a culture of contempt.

“It is a pattern of conduct by those people charged with protecting our community, and they’re circulating emails disparaging hillbillies,” he said, according to the Mountain State Spotlight.

The city of Huntington and surrounding Cabell county are suing AmerisourceBergen and two other major distributors, McKesson and Cardinal Health, as part of a series of federal cases over the pharmaceutical industry’s push to sell narcotic painkillers which created the opioid epidemic.

This is the first case to go to a full trial after AmerisourceBergen, McKesson and two other companies agreed to pay $260m to settle another of the bellwether cases in Ohio two years ago.

The two West Virginia local authorities accuse the distributors of putting profit before lives and turning Cabell county into the “ground zero” of the epidemic. A data expert told the trial that over nine years the three distributors delivered about 100m opioid doses to Cabell county – which has a population of just 90,000.

Farrell put it to Zimmerman that he failed to enforce company policies to report suspicious orders to the Drug Enforcement Administration (DEA) and to withhold deliveries while they were investigated. Zimmerman claimed that if the company had stopped deliveries it would have harmed patients who needed the drugs.

“We’re a company, we’re not an enforcement agency and we’re not a regulatory agency,” he said.

Drug distributors delivered 1.1bn opioid painkillers to West Virginia between 2006 and 2014, even as the state’s overdose rate rose to the highest in the US.

In 2017, AmerisourceBergen paid $16m to settle legal action by West Virginia over opioid deliveries but did not admit wrongdoing. The same year, McKesson paid a record $150m fine after the DEA accused it of breaking the law.

Critics, including DEA officials, have accused the companies of regarding the fines as “the cost of doing business” and then carrying on as before.

READ MORE


A wild jaguar in southern Arizona. (photo: Fort Huachuca/AP)
A wild jaguar in southern Arizona. (photo: Fort Huachuca/AP)


Groups Call for Reintroduction of Jaguars in US Southwest
Susan Montoya Bryan, Associated Press
Excerpt: "Environmental groups and scientists with two universities want U.S. wildlife managers to consider reintroducing jaguars to the American Southwest."

In a recently published paper, they say habitat destruction, highways and existing segments of the border wall mean that natural reestablishment of the large cats north of the U.S.-Mexico boundary would be unlikely over the next century without human intervention.

Jaguars are currently found in 19 countries, but biologists have said the animals have lost more than half of their historic range from South and Central America into the southwestern United States largely due to hunting and habitat loss.

Several individual male jaguars have been spotted in Arizona and New Mexico over the last two decades but there’s no evidence of breeding pairs establishing territories beyond northern Mexico. Most recently, a male jaguar was spotted just south of the border and another was seen in Arizona in January.

Scientists and experts with the Wildlife Conservation Society, the Center for Landscape Conservation, Defenders of Wildlife, the Center for Biological Diversity and other organizations are pointing to more than 31,800 square miles (82,400 square kilometers) of suitable habitat in the mountains of central Arizona and New Mexico that could potentially support anywhere from 90 to 150 jaguars.

They contend that reintroducing the cats is essential to species conservation and restoration of the region's ecosystem.

“We are attempting to start a new conversation around jaguar recovery, and this would be a project that would be decades in the making,” Sharon Wilcox of Defenders of Wildlife, one of the study’s authors, said in an interview. “There are ecological dimensions, human dimensions that would need to be addressed in a truly collaborative manner. There would need to be a number of stakeholders who would want to be at the table in order to see this project move forward.”

Under a recovery plan finalized by the U.S. Fish and Wildlife Service, Mexico as well as countries in Central and South America are primarily responsible for monitoring jaguar movements within their territory. The agency has noted that the Southwestern U.S. represents just one-tenth of 1% of the jaguar's historic range.

Environmentalists have criticized the plan, saying the U.S. government overlooked opportunities for recovery north of the international border.

While the recovery plan doesn't call for reintroductions in the U.S., federal officials have said efforts will continue to focus on sustaining habitat, eliminating poaching and improving social acceptance to accommodate those cats that find their way across the border.

The habitat highlighted by the conservation groups is rugged and made up mostly of federally managed land. They say it includes water sources, suitable cover and prey.

Fish and Wildlife Service biologists have yet to review the latest study, but such a proposal would likely face fierce opposition from ranchers and some rural residents who have been at odds with environmentalists and the Fish and Wildlife Service over the reintroduction of Mexican gray wolves. That program has faced numerous challenges over the past two decades and while wolf numbers are trending upward, ranchers say so are livestock deaths.

Jaguar advocates said losses could be mitigated through compensation programs like those established as a result of the wolf program.

Then there's the question of where the jaguars would come from. Advocates say a captive breeding program could be developed over time and jaguars from existing wild populations could be relocated.

Wilcox said there are many factors — some understood and others still being studied — that influence the movement of jaguars.

“But this is a vast area with suitable vegetation,” she said. “It’s populated with the right kind of prey for these cats and given its elevation and its latitude, it might provide an important climate refugium for the species in the future.”

READ MORE


Contribute to RSN

Update My Monthly Donation





No comments:

Post a Comment

Note: Only a member of this blog may post a comment.

NORTHCOM's Shock Drone Admission, Nuclear Talk, and Trump's Latest Threat – 8/17/26

                                                                                    LOTS OF POSTS IGNORED BY BLOGGER..... OR REMOVED ON THEI...